PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G079500.1.p
Common NameSETIT_032487mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 242aa    MW: 26000.4 Da    PI: 4.3332
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G079500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-141763248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        g+WT+eEd++lv      G  +W ++++  g+ R++k+c++rw +yl
  Seita.2G079500.1.p 17 GPWTAEEDQKLVSFLVNNGQCCWGAVPKLAGLLRCGKSCRLRWTNYL 63
                        89*****************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6421367IPR017930Myb domain
SMARTSM007175.8E-81565IPR001005SANT/Myb domain
PfamPF002494.3E-131763IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-151762IPR009057Homeodomain-like
SuperFamilySSF466892.44E-191792IPR009057Homeodomain-like
CDDcd001671.12E-81863No hitNo description
Gene3DG3DSA:1.10.10.609.1E-86392IPR009057Homeodomain-like
PROSITE profilePS500904.5656492IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MACPTVKTTA VLRQGGGPWT AEEDQKLVSF LVNNGQCCWG AVPKLAGLLR CGKSCRLRWT  60
NYLWPDLKRG LLSPEEEKTV INLHAELGNR WKMGIDPATH KPLQPAPPQP NEEEKVAAAS  120
AIVSGVELGN EAFSISEVPM VHLLADVVLP YDLVAGAPPA SNSGIDTAYS PEPSSSSSSC  180
SGSATASSCA STVVDGECLD WLEWAESMLL DDVVTGPTPW TFEDPFVTYQ RIALFDHQET  240
W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-141791881B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3673901e-63AK367390.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2056F10.
GenBankAK3752631e-63AK375263.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3089G21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956764.11e-127PREDICTED: myb-related protein 315-like
TrEMBLK4A0U61e-178K4A0U6_SETIT; Uncharacterized protein
STRINGSi032487m1e-177(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-44myb domain protein 20